PAB20577

LRRC47 antibody from Abnova Corporation
KIAA1185, RP1-286D6.3

Antibody data

Product number
PAB20577
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20577, RRID:AB_10965782
Product name
LRRC47 polyclonal antibody
Provider product page
Abnova Corporation - PAB20577
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LRRC47.
Antigen sequence
NCLDSFPAELFRPGALPLLSELAAADNCLRELSPD
IAHLASLKTLDLSNNQLSEIPAELADCPKLKEINF
RGNKLRDKRLEKMVSGCQTRSILEYLRVGGRGGGK
GKGRAE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -