HPA008512

LRRC47 antibody from Atlas Antibodies
KIAA1185, RP1-286D6.3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008512
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008512, RRID:AB_1234736
Product name
Anti-LRRC47
Provider product page
Atlas Antibodies - HPA008512
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRA
VKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQ
LEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLV
DADGDVISFPPITNSEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -