HPA008512

LRRC47 antibody from Atlas Antibodies
KIAA1185, RP1-286D6.3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008512
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008512, RRID:AB_1853324
Product name
Anti-LRRC47
Provider product page
Atlas Antibodies - HPA008512
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRA
VKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQ
LEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLV
DADGDVISFPPITNSEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -