HPA012018

LRRC47 antibody from Sigma-Aldrich
KIAA1185, RP1-286D6.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012018
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012018, RRID:AB_1853322
Product name
Anti-LRRC47 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012018
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NCLDSFPAELFRPGALPLLSELAAADNCLRELSPD
IAHLASLKTLDLSNNQLSEIPAELADCPKLKEINF
RGNKLRDKRLEKMVSGCQTRSILEYLRVGGRGGGK
GKGRAE
Storage
-20C
Provider Type Product Number
- No reagents -