HPA007876

MMEL1 antibody from Atlas Antibodies
MMEL2, NEPII, NL1, NL2, SEP

Antibody data

Product number
HPA007876
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007876, RRID:AB_1854012
Product name
Anti-MMEL1
Provider product page
Atlas Antibodies - HPA007876
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEELQSQFGLKGFNWTLFIQTVLSSVKIKLLPDEE
VVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLD
RIGSLSQRFKDTRVNYRKALFGTMVEEVRWRECVG
YVNSNMENAVGSLYVREAFPGDSKSMVRELIDKVR
TVFVETLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.