HPA008205

MMEL1 antibody from Sigma-Aldrich
MMEL2, NEPII, NL1, NL2, SEP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008205
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008205, RRID:AB_1854011
Product name
Anti-MMEL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008205
Antibody type
Polyclonal
Antigen
Membrane metallo-endopeptidase-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVIEKRGSQPLLDILEVVGGWPVAMDRWNETVGLE
WELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHI
IYIDQPTLGMPSREYYFNGGSNRKVREAYLQFMVS
VATLLREDANLPRDSCLVQEDMVQVLEL
Storage
-20C
Provider Type Product Number
- No reagents -