AV41801

CYP3A7 antibody from Sigma-Aldrich
CP37, P450-HFLA
No application information provided.

Antibody data

Product number
AV41801
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV41801, RRID:AB_1847448
Product name
Anti-CYP3A7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV41801
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CYP3A7 with an internal ID of P10849
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
SVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSET
HKALSDLELMAQSII
Storage
-20C
Provider Type Product Number
- No reagents -