HPA006403

PRXL2B antibody from Atlas Antibodies
C1orf93, FAM213B, MGC26818
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006403
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006403, RRID:AB_1853870
Product name
Anti-FAM213B
Provider product page
Atlas Antibodies - HPA006403
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGEL
YLDESKQLYKELGFKRYNSLSILPAALGKPVRDVA
AKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLH
FVQKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -