Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007350-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007350-M03, RRID:AB_1137520
- Product name
- UCP1 monoclonal antibody (M03), clone 4B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UCP1.
- Antigen sequence
PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTA
F- Isotype
- IgG
- Antibody clone number
- 4B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UCP1 monoclonal antibody (M03), clone 4B7. Western Blot analysis of UCP1 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UCP1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol