Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502432 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC29A2 antibody: synthetic peptide directed towards the C terminal of human SLC29A2
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYF
ITFML LFAVSNGYLV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nucleoside and nucleobase transporters of primary human cardiac microvascular endothelial cells: characterization of a novel nucleobase transporter.
Bone DB, Hammond JR
American journal of physiology. Heart and circulatory physiology 2007 Dec;293(6):H3325-32
American journal of physiology. Heart and circulatory physiology 2007 Dec;293(6):H3325-32
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: SLC29A2 Sample Tissue: Human Fetal Muscle Antibody Dilution: 1.0 μg/mL