ABIN502432

SLC29A2 antibody from antibodies-online
DER12, ENT2, HNP36

Antibody data

Product number
ABIN502432
Provider
antibodies-online
Product name
anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (C-Term) antibody
Provider product page
antibodies-online - ABIN502432
Antibody type
Polyclonal
Antigen
The immunogen for anti-SLC29A2 antibody: synthetic peptide directed towards the C terminal of human SLC29A2
Description
Affinity Purified
Reactivity
Human, Rat, Bovine, Canine, Rabbit
Host
Rabbit
Antigen sequence
PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYF
ITFML LFAVSNGYLV
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -