Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310509 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC29A2 antibody: synthetic peptide directed towards the N terminal of human SLC29A2
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLL
NSFLY QCVPETVRIL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Contribution of P2X7 receptors to adenosine uptake by cultured mouse astrocytes.
Functional characterization and haplotype analysis of polymorphisms in the human equilibrative nucleoside transporter, ENT2.
Okuda H, Higashi Y, Nishida K, Fujimoto S, Nagasawa K
Glia 2010 Nov 1;58(14):1757-65
Glia 2010 Nov 1;58(14):1757-65
Functional characterization and haplotype analysis of polymorphisms in the human equilibrative nucleoside transporter, ENT2.
Owen RP, Lagpacan LL, Taylor TR, De La Cruz M, Huang CC, Kawamoto M, Johns SJ, Stryke D, Ferrin TE, Giacomini KM
Drug metabolism and disposition: the biological fate of chemicals 2006 Jan;34(1):12-5
Drug metabolism and disposition: the biological fate of chemicals 2006 Jan;34(1):12-5
No comments: Submit comment
No validations: Submit validation data