HPA018168

SLC29A2 antibody from Sigma-Aldrich
DER12, ENT2, HNP36
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018168, RRID:AB_1857077
Product name
Anti-SLC29A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018168
Antibody type
Polyclonal
Antigen
Equilibrative nucleoside transporter 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFARYYLANKSSQAQAQELETKAELLQSDENGIPS
SPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTV
FQK
Storage
-20C
Provider Type Product Number
- No reagents -