HPA018168

SLC29A2 antibody from Atlas Antibodies
DER12, ENT2, HNP36
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018168
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018168, RRID:AB_1235635
Product name
Anti-SLC29A2
Provider product page
Atlas Antibodies - HPA018168
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KFARYYLANKSSQAQAQELETKAELLQSDENGIPS
SPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTV
FQK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -