H00008764-B01P

TNFRSF14 antibody from Abnova Corporation
ATAR, CD270, HVEA, HVEM, LIGHTR, TR2

Antibody data

Product number
H00008764-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008764-B01P, RRID:AB_1580020
Product name
TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008764-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TNFRSF14 protein.
Antigen sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCY
APALPSCKEDEYPVGSECCPKCSPGYRVKEACGEL
TGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGL
RASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA
YATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGT
LEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSL
VIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKR
QEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRS
PNH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -