HPA006404

TNFRSF14 antibody from MilliporeSigma / Merck KGaA
ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006404
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006404, RRID:AB_1851348
Product name
Anti-TNFRSF14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006404
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 14 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAP
ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTG
TVCEPCPPGTYIAHLNGLSKCLQCQMCD
Storage
-20C
Provider Type Product Number
- No reagents -