ABIN504655

NR2F2 antibody from antibodies-online
ARP1, COUP-TFII, COUPTF2, COUPTFB, NF-E3, SVP40, TFCOUP2

Antibody data

Product number
ABIN504655
Provider
antibodies-online
Product name
anti-Nuclear Receptor Subfamily 2, Group F, Member 2 (NR2F2) antibody
Provider product page
antibodies-online - ABIN504655
Antibody type
Polyclonal
Antigen
The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
AMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGA
PHTPQ TPGQGGPAST
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -