ABIN183799
antibody from antibodies-online
Targeting: NR2F2
ARP1, COUP-TFII, COUPTF2, COUPTFB, NF-E3, SVP40, TFCOUP2
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183799 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 2, Group F, Member 2 (NR2F2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the C terminal of human NR2F2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCAL
EEYVR SQYPNQPTRF- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Neuroprotection resulting from insufficiency of RANBP2 is associated with the modulation of protein and lipid homeostasis of functionally diverse but linked pathways in response to oxidative stress.
Immunolocalization of nuclear transcription factors, DAX-1 and COUP-TF II, in the normal human ovary: correlation with adrenal 4 binding protein/steroidogenic factor-1 immunolocalization during the menstrual cycle.
Immunolocalization of nuclear transcription factors, DAX-1 and COUP-TF II, in the normal human ovary: correlation with adrenal 4 binding protein/steroidogenic factor-1 immunolocalization during the menstrual cycle.
Cho KI, Yi H, Tserentsoodol N, Searle K, Ferreira PA
Disease models & mechanisms 2010 Sep-Oct;3(9-10):595-604
Disease models & mechanisms 2010 Sep-Oct;3(9-10):595-604
Immunolocalization of nuclear transcription factors, DAX-1 and COUP-TF II, in the normal human ovary: correlation with adrenal 4 binding protein/steroidogenic factor-1 immunolocalization during the menstrual cycle.
Sato Y, Suzuki T, Hidaka K, Sato H, Ito K, Ito S, Sasano H
The Journal of clinical endocrinology and metabolism 2003 Jul;88(7):3415-20
The Journal of clinical endocrinology and metabolism 2003 Jul;88(7):3415-20
Immunolocalization of nuclear transcription factors, DAX-1 and COUP-TF II, in the normal human ovary: correlation with adrenal 4 binding protein/steroidogenic factor-1 immunolocalization during the menstrual cycle.
Sato Y, Suzuki T, Hidaka K, Sato H, Ito K, Ito S, Sasano H
The Journal of clinical endocrinology and metabolism 2003 Jul;88(7):3415-20
The Journal of clinical endocrinology and metabolism 2003 Jul;88(7):3415-20
No comments: Submit comment
No validations: Submit validation data