HPA016591

PGAP3 antibody from Sigma-Aldrich
CAB2, MGC9753, PER1, PERLD1, PP1498
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016591
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016591, RRID:AB_1855203
Product name
Anti-PERLD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016591
Antibody type
Polyclonal
Antigen
CAB2 protein
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPI
YMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQF
HGKWP
Storage
-20C
Provider Type Product Number
- No reagents -