HPA016591

PGAP3 antibody from Atlas Antibodies
CAB2, MGC9753, PER1, PERLD1, PP1498
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016591
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016591, RRID:AB_1235162
Product name
Anti-PGAP3
Provider product page
Atlas Antibodies - HPA016591
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPI
YMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQF
HGKWP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -