HPA012036

PANK4 antibody from Sigma-Aldrich
FLJ10782
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012036, RRID:AB_1854952
Product name
Anti-PANK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012036
Antibody type
Polyclonal
Antigen
Pantothenate kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDHSGKDTEREHEPPYEISVQEEITARLHFIKFEN
TYIEACLDFIKDHLVNTETKVIQATGGGAYKFKDL
IEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFV
YQKDSDPEFRFQTNHPHIFPYLLVNIGSGVSIVKV
ETE
Storage
-20C
Provider Type Product Number
- No reagents -