HPA025079

ACTRT2 antibody from Atlas Antibodies
Arp-T2, ARPM2, FLJ25424
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025079
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025079, RRID:AB_1845048
Product name
Anti-ACTRT2
Provider product page
Atlas Antibodies - HPA025079
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQ
APEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQK
ILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTP
IKITAP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -