HPA006480

ACTRT2 antibody from Sigma-Aldrich
Arp-T2, ARPM2, FLJ25424
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006480, RRID:AB_1845047
Product name
Anti-ACTRT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006480
Antibody type
Polyclonal
Antigen
Actin-related protein T2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAE
ANQKKYFVGEEALYKQEALQLHSPFERGLITGWDD
VERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR
EKMAEVMFENFGVPAFYLSDQ
Storage
-20C
Provider Type Product Number
- No reagents -