HPA005912

CALML6 antibody from Sigma-Aldrich
CAGLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005912
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005912, RRID:AB_1845920
Product name
Anti-CALML6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005912
Antibody type
Polyclonal
Antigen
Calmodulin-like protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINP
TKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEK
AQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNA
GEPLNEVEAEQMMKEADKDGDRTIDYE
Storage
-20C
Provider Type Product Number
- No reagents -