HPA019356

TRIM4 antibody from Sigma-Aldrich
RNF87
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019356, RRID:AB_1856376
Product name
Anti-TRIM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019356
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSQRNLVAKMKKVMHLQDVEVKNATQWKDKIKSQR
MRISTEFSKLHNFLVEEEDLFLQRLNKEEEETKKK
LNENTLKLNQTIASLKKLILEVGEKSQAPTLELLQ
NPK
Storage
-20C
Provider Type Product Number
- No reagents -