HPA029461

TRIM4 antibody from MilliporeSigma / Merck KGaA
RNF87
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029461
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029461, RRID:AB_10600834
Product name
Anti-TRIM4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029461
Antibody type
Polyclonal
Antigen
tripartite motif-containing 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAVGVCREDVMGITDRSKMSPDVGIWAIYWSAAGY
WPLIGFPGTPTQQEPALHRVGVYLDRGTGNVSFYS
AVDGVHLHTFSCSSVSRLRPFFWLSPLASLVIPPV
Storage
-20C
Provider Type Product Number
- No reagents -