Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005093-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005093-A01, RRID:AB_462372
- Product name
- PCBP1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PCBP1.
- Antigen sequence
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLE
GPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
MHGGTGFAGIDSSSPEVKGYWASLDASTQT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Establishing an in vivo p48ZnF bioluminescence mouse brain imaging model.
Global analysis reveals multiple pathways for unique regulation of mRNA decay in induced pluripotent stem cells.
PCBP1 is required for maintenance of the transcriptionally silent state in fully grown mouse oocytes.
Heese K
Neuroscience letters 2013 May 10;542:97-101
Neuroscience letters 2013 May 10;542:97-101
Global analysis reveals multiple pathways for unique regulation of mRNA decay in induced pluripotent stem cells.
Neff AT, Lee JY, Wilusz J, Tian B, Wilusz CJ
Genome research 2012 Aug;22(8):1457-67
Genome research 2012 Aug;22(8):1457-67
PCBP1 is required for maintenance of the transcriptionally silent state in fully grown mouse oocytes.
Xia M, He H, Wang Y, Liu M, Zhou T, Lin M, Zhou Z, Huo R, Zhou Q, Sha J
Cell cycle (Georgetown, Tex.) 2012 Aug 1;11(15):2833-42
Cell cycle (Georgetown, Tex.) 2012 Aug 1;11(15):2833-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCBP1 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of PCBP1 expression in Y-79 ( Cat # L042V1 ).