Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031149 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031149, RRID:AB_10600694
- Product name
- Anti-CD200
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPE
NMVTFSENHGVVIQPAYKDKINITQLGLQNSTITF
WNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQP
IVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CD200 and CD200R1 are differentially expressed and have differential prognostic roles in non-small cell lung cancer
B cell follicle sanctuary permits persistent productive simian immunodeficiency virus infection in elite controllers
Yoshimura K, Suzuki Y, Inoue Y, Tsuchiya K, Karayama M, Iwashita Y, Kahyo T, Kawase A, Tanahashi M, Ogawa H, Inui N, Funai K, Shinmura K, Niwa H, Sugimura H, Suda T
OncoImmunology 2020;9(1)
OncoImmunology 2020;9(1)
B cell follicle sanctuary permits persistent productive simian immunodeficiency virus infection in elite controllers
Fukazawa Y, Lum R, Okoye A, Park H, Matsuda K, Bae J, Hagen S, Shoemaker R, Deleage C, Lucero C, Morcock D, Swanson T, Legasse A, Axthelm M, Hesselgesser J, Geleziunas R, Hirsch V, Edlefsen P, Piatak M, Estes J, Lifson J, Picker L
Nature Medicine 2015;21(2):132-139
Nature Medicine 2015;21(2):132-139
No comments: Submit comment
No validations: Submit validation data