HPA003085

TMX1 antibody from Sigma-Aldrich
PDIA11, TMX, TXNDC, TXNDC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003085
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003085, RRID:AB_1080424
Product name
Anti-TMX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003085
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEED
VSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
Storage
-20C
Provider Type Product Number
- No reagents -