WH0005164M2

PDK2 antibody from Sigma-Aldrich
PDHK2
ELISA
Recommended by provider

Antibody data

Product number
WH0005164M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0005164M2, RRID:AB_1842920
Product name
Monoclonal Anti-PDK2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0005164M2
Antibody type
Monoclonal
Antigen
PDK2 (AAH05811, a.a. 187-276) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPD
LEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNA
MRATVESHESSLILPPIKVM (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -