Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405975 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acetyl-CoA Acyltransferase 1 (ACAA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
AVLKD VNLRPEQLGD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references BAFF supports human B cell differentiation in the lymphoid follicles through distinct receptors.
Polymorphism of the ACE Gene in dialysis patients: overexpression of DD genotype in type 2 diabetic end-stage renal failure patients.
Zhang X, Park CS, Yoon SO, Li L, Hsu YM, Ambrose C, Choi YS
International immunology 2005 Jun;17(6):779-88
International immunology 2005 Jun;17(6):779-88
Polymorphism of the ACE Gene in dialysis patients: overexpression of DD genotype in type 2 diabetic end-stage renal failure patients.
Park HC, Choi SR, Kim BS, Lee TH, Kang BS, Choi KH, Lee HY, Han DS, Ha SK
Yonsei medical journal 2005 Dec 31;46(6):779-87
Yonsei medical journal 2005 Dec 31;46(6):779-87
No comments: Submit comment
No validations: Submit validation data