HPA007244

ACAA1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007244
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007244, RRID:AB_1078084
Product name
Anti-ACAA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007244
Antibody type
Polyclonal
Antigen
3-Ketoacyl-CoA thiolase, peroxisomal precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQF
LSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGS
YDIGMACGVESMSLADRGNPGNITSRLMEKEKARD
CLIPMGITSENVAERFGISREKQ
Storage
-20C
Provider Type Product Number
- No reagents -