HPA023591

ZSCAN21 antibody from Atlas Antibodies
DKFZp434L134, NY-REN-21, Zipro1, ZNF38
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023591
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023591, RRID:AB_1859037
Product name
Anti-ZSCAN21
Provider product page
Atlas Antibodies - HPA023591
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFS
NSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTL
HYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEE
APYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNE
CGKSFSQHA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -