HPA023456

ZNF566 antibody from Sigma-Aldrich
FLJ14779, MGC12515
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023456
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023456, RRID:AB_2221143
Product name
Anti-ZNF566 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023456
Antibody type
Polyclonal
Antigen
Zinc finger protein 566 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQCSSFRDDWECNRQFKKELGSQGGHFNQLVFTHE
DLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRH
GSQFATHEIIHTIEK
Storage
-20C
Provider Type Product Number
- No reagents -