Antibody data

Product number
ABIN183832
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 382 (ZNF382) antibody
Provider product page
antibodies-online - ABIN183832
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF382 antibody: synthetic peptide directed towards the N terminal of human ZNF382
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDV
MLENY CHFVSVGFHM
Vial size
0.1 mg
Provider Type Product Number
- No reagents -