HPA049259

ZNF382 antibody from Atlas Antibodies
FLJ14686, KS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA049259
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049259, RRID:AB_2680694
Product name
Anti-ZNF382
Provider product page
Atlas Antibodies - HPA049259
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEY
NKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFL
CRKPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -