AV39726

ZNF382 antibody from Sigma-Aldrich
FLJ14686, KS1
No application information provided.

Antibody data

Product number
AV39726
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV39726, RRID:AB_1859227
Product name
Anti-ZNF382 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV39726
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF382 with an internal ID of P21751
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
PLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVM
LENYCHFVSVGFHMA
Storage
-20C
Provider Type Product Number
- No reagents -