Antibody data

Product number
H00084649-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084649-M03, RRID:AB_1137165
Product name
DGAT2 monoclonal antibody (M03), clone 4C1
Provider product page
Abnova Corporation - H00084649-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DGAT2.
Antigen sequence
IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSD
TWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLY
HTMYMEALVKLFDKHKTKFGLPETEVLEVN
Isotype
IgG
Antibody clone number
4C1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -