HPA013351

DGAT2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013351
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013351, RRID:AB_1847630
Product name
Anti-DGAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013351
Antibody type
Polyclonal
Antigen
Diacylglycerol O-acyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGE
NEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHG
RGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPT
QQDIDLYHTMYMEALVKLFDKHKTKFG
Storage
-20C
Provider Type Product Number
- No reagents -