Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184243 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Serotonin Receptor 7 (HTR7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEK
VVIGS ILTLITLLTI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Positive association of the serotonin 5-HT7 receptor gene with schizophrenia in a Japanese population.
Ikeda M, Iwata N, Kitajima T, Suzuki T, Yamanouchi Y, Kinoshita Y, Ozaki N
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2006 Apr;31(4):866-71
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2006 Apr;31(4):866-71
No comments: Submit comment
No validations: Submit validation data