Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184244 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Serotonin Receptor 7 (HTR7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEK
VVIGS ILTLITLLTI- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Four 5-hydroxytryptamine7 (5-HT7) receptor isoforms in human and rat produced by alternative splicing: species differences due to altered intron-exon organization.
Heidmann DE, Metcalf MA, Kohen R, Hamblin MW
Journal of neurochemistry 1997 Apr;68(4):1372-81
Journal of neurochemistry 1997 Apr;68(4):1372-81
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: HTR7Lane A: MarkerLane B: Jurkat cell lysates Antibody Dilution: 0.125 μg/mL