HPA023937

ZNF567 antibody from Sigma-Aldrich
MGC45586
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023937, RRID:AB_1859351
Product name
Anti-ZNF567 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023937
Antibody type
Polyclonal
Antigen
Zinc finger protein 567 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEVKSHNQSARAFSHNEVLMQYQKTETPAQSFGYN
DCEKSFLQRGGLITHSRPYKGENPSVY
Storage
-20C
Provider Type Product Number
- No reagents -