Antibody data

Product number
H00004199-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004199-M03, RRID:AB_530121
Product name
ME1 monoclonal antibody (M03), clone 3H5
Provider product page
Abnova Corporation - H00004199-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant ME1.
Antigen sequence
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEER
QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD
RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPT
VGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW
PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLA
LYTACGGMNPQECLPVILDVGTENEELLKDPLYIG
LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFE
DFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG
LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVM
ALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE
KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGA
FSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNS
YVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS
DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEK
TATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP
EEVQKIQTKVDQ
Isotype
IgG
Antibody clone number
3H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -