HPA006493

ME1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006493
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006493, RRID:AB_1078272
Product name
Anti-ME1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006493
Antibody type
Polyclonal
Antigen
NADP-dependent malic enzyme recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RITKNKLSDQTILFQGAGEAALGIAHLIVMALEKE
GLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFA
HEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQI
LKDMAAFNERPIIFALSNPTSKAEC
Storage
-20C
Provider Type Product Number
- No reagents -