ABIN502654

NR5A1 antibody from antibodies-online
AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1, SF1
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN502654
Provider
antibodies-online
Product name
anti-Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502654
Antibody type
Polyclonal
Antigen
The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1
Description
Affinity Purified
Reactivity
Human, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAH
GPLAG YLYPAFPGRA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -