HPA008257

TGFBR3 antibody from Sigma-Aldrich
betaglycan, BGCAN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008257
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008257, RRID:AB_1080258
Product name
Anti-TGFBR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008257
Antibody type
Polyclonal
Antigen
TGF-beta receptor type III precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTR
PRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDL
ESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVR
NPSSFQEQPHGNITFNMELYNTDLF
Storage
-20C
Provider Type Product Number
- No reagents -