HPA027997

ZPBP2 antibody from Sigma-Aldrich
MGC41930, ZPBPL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027997, RRID:AB_1859488
Product name
Anti-ZPBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027997
Antibody type
Polyclonal
Antigen
Zona pellucida-binding protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQAR
DRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVV
RLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDV
NVTCQTCVSVLTYGAKSCPQT
Storage
-20C
Provider Type Product Number
- No reagents -