Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406349 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Olfactomedin-Like 2A (OLFML2A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OLFML2A antibody: synthetic peptide directed towards the N terminal of human OLFML2A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKM
EKLKK QAPELLKLQS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
No comments: Submit comment
No validations: Submit validation data