H00116986-M

AGAP2 antibody from Abnova Corporation
CENTG1
No application information provided.

Antibody data

Product number
H00116986-M
Provider
Abnova Corporation
Product name
AGAP2 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00116986-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant AGAP2.
Antigen sequence
MHAQRQFVVAAVRAEVRRHEVAKQALNRLRKLAER
VDDPELQDSIQASLDSIREAVINSQEWTLSRSIPE
LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQ
YKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVI
FVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALA
LVGTQDRISASSPRVVGDARARALCADMKRCSYYE
TCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKS
LPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSP
NVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFA
NRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKR
SGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHST
HGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGL
VKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQ
TSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPP
SPMVKKQRRKKLTTPSKTEGSAGQAEEENFEFLIV
SSTGQTWHFEAASFEERDAWVQAIESQILASLQCC
ESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGA
PNPTWASLNLGALICIECSGIHRNLGTHLSRVRSL
DLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKP
SRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGR
QLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQL
RSPLHLAAELAHVVITQLLLWYGADVAARDAQGRT
ALFYARQAGSQLCADILLQHGCPGEGGSAATTPSA
ATTPSITATPSPRRRSSAASVGRADAPVALV
Provider Type Product Number
- No reagents -