HPA023474

AGAP2 antibody from Sigma-Aldrich
CENTG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023474
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023474, RRID:AB_1855378
Product name
Anti-AGAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023474
Antibody type
Polyclonal
Antigen
Arf-GAP, GTPase, ANK repeat and PH domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPS
SLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLS
PLSREPPPSPMVKKQRRKKLTTPSKTE
Storage
-20C
Provider Type Product Number
- No reagents -