Antibody data

Product number
ABIN503175
Provider
antibodies-online
Product name
anti-NAD Dependent Malate Dehydrogenase (NAD-ME) antibody
Provider product page
antibodies-online - ABIN503175
Antibody type
Polyclonal
Antigen
The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNL
KKMTS PLEKYIYIMG
Vial size
50 µg
Provider Type Product Number
- No reagents -