Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008880 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008880, RRID:AB_1853702
- Product name
- Anti-ME2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KVISKPISEHKILFLGAGEAALGIANLIVMSMVEN
GLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPF
THSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFT
PDVIRAMASINERPVIFALSNPTA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Chronic reduction of the cytosolic or mitochondrial NAD(P)-malic enzyme does not affect insulin secretion in a rat insulinoma cell line.
Succinate is the controller of O 2 − /H2O2 release at mitochondrial complex I : negative modulation by malate, positive by cyanide
Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells.
Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells.
Brown LJ, Longacre MJ, Hasan NM, Kendrick MA, Stoker SW, Macdonald MJ
The Journal of biological chemistry 2009 Dec 18;284(51):35359-67
The Journal of biological chemistry 2009 Dec 18;284(51):35359-67
Succinate is the controller of O 2 − /H2O2 release at mitochondrial complex I : negative modulation by malate, positive by cyanide
Zoccarato F, Cavallini L, Alexandre A
Journal of Bioenergetics and Biomembranes 2009 August;41(4):387-393
Journal of Bioenergetics and Biomembranes 2009 August;41(4):387-393
Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells.
MacDonald MJ, Longacre MJ, Kendrick MA
Archives of biochemistry and biophysics 2009 Aug 15;488(2):100-4
Archives of biochemistry and biophysics 2009 Aug 15;488(2):100-4
Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells.
MacDonald MJ, Longacre MJ, Kendrick MA
Archives of biochemistry and biophysics 2009 Aug 15;488(2):100-4
Archives of biochemistry and biophysics 2009 Aug 15;488(2):100-4
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-ME2 antibody HPA008880 (A) shows similar pattern to independent antibody HPA008247 (B).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human duodenum and liver tissues using Anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-ME2 antibody HPA008880.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-ME2 antibody HPA008880.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-ME2 antibody HPA008880.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-ME2 antibody HPA008880.
- Sample type
- HUMAN